VRK1 Antikörper (C-Term)

Produktnummer ABIN3044560

Produktdetails anti-VRK1 Antikörper

Target: VRK1 (Vaccinia Related Kinase 1 (VRK1))

Bindungsspezifität: AA 292-329, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VRK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human,Rat.

Sequenz: EKNKPGEIAK YMETVKLLDY TEKPLYENLR DILLQGLK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human,Rat.
Gene Name: vaccinia related kinase 1
Protein Name: Serine/threonine-protein kinase VRK1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK), different from the related mouse sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu VRK1

Target: VRK1 (Vaccinia Related Kinase 1 (VRK1))

Andere Bezeichnung: VRK1 (VRK1 Produkte)

Synonyme: vrk1 antikoerper, MGC64390 antikoerper, MGC75762 antikoerper, VRK1 antikoerper, PCH1 antikoerper, PCH1A antikoerper, 51PK antikoerper, wu:fe16f06 antikoerper, zgc:56266 antikoerper, vaccinia related kinase 1 L homeolog antikoerper, vaccinia related kinase 1 antikoerper, Serine/threonine-protein kinase VRK1 antikoerper, vrk1.L antikoerper, vrk1 antikoerper, VRK1 antikoerper, vrk-1 antikoerper, Vrk1 antikoerper

Hintergrund: Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 Molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Synonyms: MGC117401 antibody|MGC138280 antibody|MGC142070 antibody|PCH1 antibody|PCH1A antibody|Serine/threonine protein kinase VRK1 antibody| Serine/threonine-protein kinase VRK1 antibody|Vaccinia related kinase 1 antibody|Vaccinia virus B1R related kinase 1 antibody| Vaccinia-related kinase 1 antibody|VRK1 antibody|VRK1_HUMAN antibody

Gen-ID: 7443

UniProt: Q99986