YY1 Antikörper (Middle Region)
-
- Target Alle YY1 Antikörper anzeigen
- YY1 (YY1 Transcription Factor (YY1))
-
Bindungsspezifität
- AA 206-241, Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser YY1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Transcriptional repressor protein YY1(YY1) detection. Tested with WB in Human,Rat.
- Sequenz
- EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Transcriptional repressor protein YY1(YY1) detection. Tested with WB in Human,Rat.
Gene Name: YY1 transcription factor
Protein Name: Transcriptional repressor protein YY1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product YY1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- YY1 (YY1 Transcription Factor (YY1))
- Andere Bezeichnung
- YY1 (YY1 Produkte)
- Synonyme
- yy1-a antikoerper, FIII antikoerper, MGC83714 antikoerper, yy1l antikoerper, zgc:64207 antikoerper, YY1 antikoerper, LOC494431 antikoerper, xyy1 antikoerper, delta antikoerper, nf-e1 antikoerper, ucrbp antikoerper, yin-yang-1 antikoerper, LOC100304682 antikoerper, ino80s antikoerper, yy1 antikoerper, DELTA antikoerper, INO80S antikoerper, NF-E1 antikoerper, UCRBP antikoerper, YIN-YANG-1 antikoerper, AW488674 antikoerper, fb59g10 antikoerper, wu:fa16g07 antikoerper, wu:fb59g10 antikoerper, YY1 transcription factor L homeolog antikoerper, YY1 transcription factor b antikoerper, YY1 transcription factor antikoerper, transcriptional repressor protein YY1 antikoerper, YY1 transcription factor S homeolog antikoerper, YY1 transcription factor a antikoerper, YY2 transcription factor antikoerper, yy1.L antikoerper, yy1b antikoerper, YY1 antikoerper, yy1 antikoerper, LOC100304682 antikoerper, yy1.S antikoerper, Yy1 antikoerper, yy1a antikoerper, YY2 antikoerper
- Hintergrund
-
YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Synonyms: CF1 antibody|Delta antibody|Delta transcription factor antibody|INO80 complex subunit S antibody|INO80S antibody|NF E1 antibody|NF-E1 antibody|NFE1 antibody|OTTHUMP00000197459 antibody|Transcriptional repressor protein YY1 antibody|TYY1_HUMAN antibody|UCR motif DNA binding protein antibody|UCRBP antibody|Yin and yang 1 antibody|Yin and Yang 1 protein antibody|Yin Yang 1 antibody|Ying Yang 1 antibody|YY 1 antibody|YY 1 transcription factor antibody|YY-1 antibody|YY1 antibody|YY1 transcription factor antibody - Gen-ID
- 7528
- UniProt
- P25490
-