ACADVL Antikörper (C-Term)
-
- Target Alle ACADVL Antikörper anzeigen
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
-
Bindungsspezifität
- AA 538-576, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACADVL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.
- Sequenz
- RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human,Rat.
Gene Name: acyl-CoA dehydrogenase, very long chain
Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ACADVL Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
- Andere Bezeichnung
- ACADVL (ACADVL Produkte)
- Synonyme
- ACAD6 antikoerper, LCACD antikoerper, VLCAD antikoerper, vlcad antikoerper, fb52d04 antikoerper, wu:fb52d04 antikoerper, wu:fc75e01 antikoerper, zgc:64067 antikoerper, acyl-CoA dehydrogenase very long chain antikoerper, acyl-Coenzyme A dehydrogenase, very long chain antikoerper, acyl-CoA dehydrogenase, very long chain antikoerper, ACADVL antikoerper, Acadvl antikoerper, acadvl antikoerper
- Hintergrund
-
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Synonyms: ACAD 6 | ACAD6 | Acadvl | LCACD | VLCAD | P49748 - Gen-ID
- 37
- UniProt
- P49748
- Pathways
- ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process
-