ACTN3 Antikörper (C-Term)

Produktnummer ABIN4886420

Produktdetails anti-ACTN3 Antikörper

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Bindungsspezifität: AA 574-617, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EADRERGAIM GIQGEIQKIC QTYGLRPCST NPYITLSPQD INT

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: actinin alpha 3 (gene/pseudogene)
Protein Name: Alpha-actinin-3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Andere Bezeichnung: ACTN3 (ACTN3 Produkte)

Synonyme: CG8953 antikoerper, Dmel\\CG8953 antikoerper, ORF1 antikoerper, acta-3 antikoerper, dabp antikoerper, ACTN2 antikoerper, actn3 antikoerper, actnl antikoerper, zgc:63559 antikoerper, fb95c03 antikoerper, wu:fb95c03 antikoerper, wu:fc11d03 antikoerper, zgc:77243 antikoerper, actinin alpha 3 (gene/pseudogene) antikoerper, actinin alpha 3 antikoerper, alpha actinin 3 antikoerper, actinin alpha 3a antikoerper, actinin alpha 3 (gene/pseudogene) L homeolog antikoerper, alpha-actinin-3 antikoerper, actinin alpha 3b antikoerper, ACTN3 antikoerper, Actn3 antikoerper, actn3a antikoerper, actn3.L antikoerper, actn3 antikoerper, LOC100439754 antikoerper, actn3b antikoerper

Hintergrund: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Synonyms: Actinin alpha 3 | Alpha-Actinin 3 | Alpha-actinin-3 | ACTN 3 | ACTN3 | Q08043

Gen-ID: 89

UniProt: Q08043

Pathways: Cell-Cell Junction Organization