BDKRB2 Antikörper (C-Term)
-
- Target Alle BDKRB2 Antikörper anzeigen
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Bindungsspezifität
- AA 357-391, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BDKRB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.
- Sequenz
- RSEPIQMENS MGTLRTSISV ERQIHKLQDW AGSRQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.
Gene Name: bradykinin receptor B2
Protein Name: B2 bradykinin receptor - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product BDKRB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Andere Bezeichnung
- BDKRB2 (BDKRB2 Produkte)
- Synonyme
- BDKRB2 antikoerper, b2r antikoerper, bk2 antikoerper, bk-2 antikoerper, bkr2 antikoerper, brb2 antikoerper, kinrec antikoerper, B2R antikoerper, BK-2 antikoerper, BK2 antikoerper, BKR2 antikoerper, BRB2 antikoerper, B2BKR antikoerper, B2BRA antikoerper, B(2) antikoerper, B2 antikoerper, BK2R antikoerper, Bdkrb2 antikoerper, bradykinin receptor B2 antikoerper, bradykinin receptor, beta 2 antikoerper, bradykinin type 2 receptor antikoerper, Bdkrb2 antikoerper, BDKRB2 antikoerper, bdkrb2 antikoerper, kinrec antikoerper, B2R antikoerper
- Hintergrund
-
Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
Synonyms: B2 | B2BKR | B2BRA | B2R | BDKR B2 | BDKRB 2 | BDKRB2 | BK 2 | BK 2 receptor | BK R2 | BK-2 receptor | BK2 | BK2 receptor | BK2R | BKR 2 | BKR2 | BR B2 | BRB 2 | BRB2 | Kinin B2 | P30411 - Gen-ID
- 624
- UniProt
- P30411
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-