Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Caspase 8 Antikörper (N-Term)

CASP8 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN4886501
  • Target Alle Caspase 8 (CASP8) Antikörper anzeigen
    Caspase 8 (CASP8)
    Bindungsspezifität
    • 16
    • 16
    • 9
    • 7
    • 6
    • 6
    • 6
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 410-449, N-Term
    Reaktivität
    • 134
    • 68
    • 61
    • 23
    • 16
    • 16
    • 10
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 126
    • 24
    • 6
    • 2
    Kaninchen
    Klonalität
    • 125
    • 32
    Polyklonal
    Konjugat
    • 94
    • 15
    • 11
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser Caspase 8 Antikörper ist unkonjugiert
    Applikation
    • 139
    • 48
    • 44
    • 39
    • 27
    • 26
    • 24
    • 19
    • 18
    • 17
    • 7
    • 4
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Verwendungszweck
    Rabbit IgG polyclonal antibody for Caspase-8(CASP8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequenz
    VSYRNPAEGT WYIQSLCQSL RERCPRGDDI LTILTEVNYE
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for Caspase-8(CASP8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: caspase 8
    Protein Name: Caspase-8
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 8 (410-449aa VSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYE), different from the related mouse and rat sequences by seven amino acids.
    Isotyp
    IgG
    Top Product
    Discover our top product CASP8 Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handhabung
    Avoid repeated freezing and thawing.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Guo, Fu, Wang, Wang, Li, Huang, Gao, Li: "Di-2-pyridylhydrazone Dithiocarbamate Butyric Acid Ester Exerted Its Proliferative Inhibition against Gastric Cell via ROS-Mediated Apoptosis and Autophagy." in: Oxidative medicine and cellular longevity, Vol. 2018, pp. 4950705, (2018) (PubMed).

    Zhan, Hu, Yi, An, Huang: "[Corrigendum] Inhibitory activity of apogossypol in human prostate cancer in vitro and in vivo." in: Molecular medicine reports, Vol. 17, Issue 6, pp. 8010, (2018) (PubMed).

    Zhou, He, Wang, Xie, Liu, Liu, Song, Ma: "Intravenous Administration Is an Effective and Safe Route for Cancer Gene Therapy Using the Bifidobacterium-Mediated Recombinant HSV-1 Thymidine Kinase and Ganciclovir." in: International journal of molecular sciences, Vol. 17, Issue 6, (2017) (PubMed).

    Zhou, Hong, Yu, Nie, Gong, Xiong, Xie: "Exopolysaccharides from Lactobacillus plantarum NCU116 induce c-Jun dependent Fas/Fasl-mediated apoptosis via TLR2 in mouse intestinal epithelial cancer cells." in: Scientific reports, Vol. 7, Issue 1, pp. 14247, (2017) (PubMed).

    Zhang, Huang, Wang, Luo, Wang: "2-DG-Regulated RIP and c-FLIP Effect on Liver Cancer Cell Apoptosis Induced by TRAIL." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 21, pp. 3442-8, (2016) (PubMed).

    Li, Wu, Sun, Zhao, Liu, Zhang: "Croton Tiglium Extract Induces Apoptosis via Bax/Bcl-2 Pathways in Human Lung Cancer A549 Cells" in: Asian Pacific journal of cancer prevention : APJCP, Vol. 17, Issue 11, pp. 4893-4898, (2016) (PubMed).

    Zhan, Hu, Yi, An, Huang: "Inhibitory activity of apogossypol in human prostate cancer in vitro and in vivo." in: Molecular medicine reports, Vol. 11, Issue 6, pp. 4142-8, (2015) (PubMed).

    Lian, Ni, Dai, Su, Smith, Xu, He: "Sorafenib sensitizes (-)-gossypol-induced growth suppression in androgen-independent prostate cancer cells via Mcl-1 inhibition and Bak activation." in: Molecular cancer therapeutics, Vol. 11, Issue 2, pp. 416-26, (2012) (PubMed).

    Zicha, Novotný: "[Relation between the sensitivity of the taste analyzer and high blood pressure]." in: Vnitr̆ní lékar̆ství, Vol. 32, Issue 7, pp. 642-6, (1986) (PubMed).

  • Target
    Caspase 8 (CASP8)
    Andere Bezeichnung
    CASP8 (CASP8 Produkte)
    Synonyme
    casp8-A antikoerper, xCaspase-8 antikoerper, casp8 antikoerper, CASP8 antikoerper, CASP-8 antikoerper, FLICE antikoerper, MACH antikoerper, Mch5 antikoerper, ALPS2B antikoerper, CAP4 antikoerper, Casp-8 antikoerper, MCH5 antikoerper, caspase-8 antikoerper, zgc:92075 antikoerper, caspase 8 L homeolog antikoerper, death related ced-3/Nedd2-like protein antikoerper, caspase 8 antikoerper, caspase-8 antikoerper, caspase-8-like antikoerper, caspase 8, apoptosis-related cysteine peptidase antikoerper, casp8.L antikoerper, LOC661095 antikoerper, CASP8 antikoerper, LOC5563818 antikoerper, casp8 antikoerper, LOC100222284 antikoerper, Casp8 antikoerper
    Hintergrund
    CASP8 is also known as CAP4, MACH or MCH5. This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. In addtion, this protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.

    Synonyms: Apoptotic protease Mch 5 | Apoptotic protease Mch5 | Apoptotic protease Mch-5 | CAP 4 | CAP4 | CASP 8 | CASP8 | CASP-8 | Caspase 8 | Caspase8 | Caspase8(CASP8) | Caspase-8(CASP-8) | CED 3 | FADD Like ICE | FADD-like ICE | FLICE | MACH | MCH 5 | MCH5 | Q14790
    Gen-ID
    841
    UniProt
    Q14790
    Pathways
    Apoptose, Caspase Kaskade in der Apoptose, TLR Signalweg, Activation of Innate immune Response, Tube Formation, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades
Sie sind hier:
Kundenservice