Cyclin T1 Antikörper (Middle Region)

Produktnummer ABIN4886509

Produktdetails anti-Cyclin T1 Antikörper

Target: Cyclin T1 (CCNT1)

Bindungsspezifität: AA 375-410, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cyclin T1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cyclin-T1(CCNT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: QKQNSKSVPS AKVSLKEYRA KHAEELAAQK RQLENM

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cyclin-T1(CCNT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cyclin T1
Protein Name: Cyclin-T1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Cyclin T1

Target: Cyclin T1 (CCNT1)

Andere Bezeichnung: CCNT1 (CCNT1 Produkte)

Synonyme: CG6292 antikoerper, Dmcyclin T antikoerper, Dmel\\CG6292 antikoerper, ORE-14 antikoerper, P-TEFb antikoerper, anon-74EFc antikoerper, dT antikoerper, p124 antikoerper, Cyclin-T1 antikoerper, ccnt antikoerper, cyct1 antikoerper, CCNT antikoerper, CYCT1 antikoerper, HIVE1 antikoerper, 2810478G24Rik antikoerper, AI115585 antikoerper, CycT1 antikoerper, fi75b02 antikoerper, si:dkey-18f23.10 antikoerper, wu:fi75b02 antikoerper, Cyclin T antikoerper, cyclin T1 antikoerper, cyclin T1 L homeolog antikoerper, CycT antikoerper, CCNT1 antikoerper, ccnt1 antikoerper, Ccnt1 antikoerper, ccnt1.L antikoerper

Hintergrund: Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

Synonyms: CCN T1 | CCNT | CCNT 1 | CCNT1 | CyclinT | Cyclin T | Cyclin-T | cyclinT1 | cyclin-T1 | cyclin T1 | Cyclin T1b | CYCT 1 | CYCT1 | HIVE1 | O60563

Gen-ID: 904

UniProt: O60563