Cofilin 2 Antikörper (C-Term)

Produktnummer ABIN4886538

Produktdetails anti-Cofilin 2 Antikörper

Target: Cofilin 2 (CFL2)

Bindungsspezifität: AA 121-153, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cofilin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KDAIKKKFTG IKHEWQVNGL DDIKDRSTLG EKL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cofilin 2
Protein Name: Cofilin-2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Cofilin 2

Target: Cofilin 2 (CFL2)

Andere Bezeichnung: CFL2 (CFL2 Produkte)

Synonyme: NEM7 antikoerper, CFL2 antikoerper, zgc:77288 antikoerper, cf12 antikoerper, cofilin 2 antikoerper, cofilin 2 (non-muscle) antikoerper, cofilin 2 (muscle) antikoerper, cofilin 2, muscle antikoerper, cofilin-2 antikoerper, CFL2 antikoerper, cfl2 antikoerper, Cfl2 antikoerper, cf12 antikoerper, LOC100359205 antikoerper

Hintergrund: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH -dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.

Synonyms: CFL 2 | CFL2 | CFL-2 | Cofilin 2 muscle | Cofilin | Cofilin muscle | Cofilin2 | Cofilin 2 | Cofilin-2 | NEM 7 | NEM7 | Q9Y281

Gen-ID: 1073

UniProt: Q9Y281

Pathways: Caspase Kaskade in der Apoptose