DDAH2 Antikörper (C-Term)

Produktnummer ABIN4886561

Produktdetails anti-DDAH2 Antikörper

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Bindungsspezifität: AA 190-224, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDAH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 2(DDAH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DAAQKAVRAM AVLTDHPYAS LTLPDDAAAD CLFLR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 2(DDAH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: dimethylarginine dimethylaminohydrolase 2
Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu DDAH2

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Andere Bezeichnung: DDAH2 (DDAH2 Produkte)

Synonyme: ddah2 antikoerper, MGC84290 antikoerper, g6a antikoerper, ddah antikoerper, ng30 antikoerper, ddahii antikoerper, MGC89103 antikoerper, DDAH2 antikoerper, DDAH antikoerper, DDAHII antikoerper, G6a antikoerper, NG30 antikoerper, 1110003M04Rik antikoerper, AU019324 antikoerper, AW413173 antikoerper, DDAH-2 antikoerper, Ddah antikoerper, dimethylarginine dimethylaminohydrolase 2 antikoerper, dimethylarginine dimethylaminohydrolase 2 L homeolog antikoerper, ddah2 antikoerper, ddah2.L antikoerper, DDAH2 antikoerper, Ddah2 antikoerper

Hintergrund: DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.

Synonyms: DDAH | DDAH II | DDAHII | DDAH2 | DDAH-2 | DDAH 2 | Dimethylargininase 2 | Dimethylargininase-2 | G6a | NG30 | Protein G6a | S phase protein | S-phase protein | O95865

Gen-ID: 23564

UniProt: O95865