Fibrinogen beta Chain Antikörper (Middle Region)
-
- Target Alle Fibrinogen beta Chain (FGB) Antikörper anzeigen
- Fibrinogen beta Chain (FGB)
-
Bindungsspezifität
- AA 193-225, Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fibrinogen beta Chain Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Fibrinogen beta chain (FGB) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- TNLRVLRSIL ENLRSKIQKL ESDVSAQMEY CRT
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Fibrinogen beta chain (FGB) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: fibrinogen beta chain
Protein Name: Fibrinogen beta chain - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product FGB Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Fibrinogen beta Chain (FGB)
- Andere Bezeichnung
- FGB (FGB Produkte)
- Synonyme
- FGB antikoerper, 2510049G14Rik antikoerper, DKFZp470D0312 antikoerper, LOC100223598 antikoerper, fibrinogen antikoerper, Ab1-216 antikoerper, Ac1-581 antikoerper, wu:fa55c11 antikoerper, zgc:77116 antikoerper, fgb antikoerper, fibrinogen beta chain antikoerper, fibrinogen beta chain L homeolog antikoerper, FGB antikoerper, Fgb antikoerper, fgb antikoerper, fgb.L antikoerper
- Hintergrund
-
Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms: FGB | Fibrinogen beta chain | Fibrinopeptide B | HEL S 78p | HEL-S-78p | P02675 - Gen-ID
- 2244
- UniProt
- P02675
-