GLA Antikörper (C-Term)

Produktnummer ABIN4886604

Produktdetails anti-GLA Antikörper

Target: GLA (Galactosidase, alpha (GLA))

Bindungsspezifität: AA 218-275, C-Term

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.

Sequenz: DIQYYCNHWR NFDDVYDSWE SIKNILSWTV VYQKEIVEVA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.
Gene Name: galactosidase, alpha
Protein Name: Alpha-galactosidase A

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu GLA

Target: GLA (Galactosidase, alpha (GLA))

Andere Bezeichnung: Gla (GLA Produkte)

Synonyme: GALA antikoerper, Ags antikoerper, zgc:101584 antikoerper, MGC130872 antikoerper, SMU.877 antikoerper, SCF11.21 antikoerper, AO090005000217 antikoerper, alpha-GAL antikoerper, galactosidase alpha antikoerper, galactosidase, alpha antikoerper, galactosidase alpha S homeolog antikoerper, alpha-galactosidase antikoerper, aga antikoerper, alpha-galactosidase A antikoerper, GLA antikoerper, Gla antikoerper, gla antikoerper, gla.S antikoerper, agaN antikoerper, aga antikoerper, agaL antikoerper, SCO0541 antikoerper, rafA antikoerper, melA antikoerper, galA antikoerper, ANI_1_2528074 antikoerper, ANI_1_1502124 antikoerper, AOR_1_390174 antikoerper, CpipJ_CPIJ002066 antikoerper, MCYG_00962 antikoerper, MCYG_00791 antikoerper, Tsp_02909 antikoerper, Tsp_02508 antikoerper

Hintergrund: Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Synonyms: Ags | Agalsidase alfa | Alpha D galactosidase A | Alpha gal A | GALA | Galactosidase, alpha | GLA | GLA protein | Melibiase | P06280

Gen-ID: 11605

UniProt: P51569

Pathways: SARS-CoV-2 Protein Interaktom