GPI Antikörper (N-Term)
-
- Target Alle GPI Antikörper anzeigen
- GPI (Glucose-6-Phosphate Isomerase (GPI))
-
Bindungsspezifität
- AA 5-39, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPI Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Human.
- Sequenz
- TRDPQFQKLQ QWYREHRSEL NLRRLFDANK DRFNH
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Human.
Gene Name: glucose-6-phosphate isomerase
Protein Name: Glucose-6-phosphate isomerase - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human GPI (5-39aa TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH), different from the related mouse and rat sequences by sixteen amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product GPI Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GPI (Glucose-6-Phosphate Isomerase (GPI))
- Andere Bezeichnung
- GPI (GPI Produkte)
- Synonyme
- PGI antikoerper, Amf antikoerper, Gpi1 antikoerper, GPI antikoerper, DDBDRAFT_0185620 antikoerper, DDBDRAFT_0231026 antikoerper, DDB_0185620 antikoerper, DDB_0231026 antikoerper, CG8251 antikoerper, Dmel\\CG8251 antikoerper, Gpi antikoerper, pgi antikoerper, Gpi-1 antikoerper, Gpi-1r antikoerper, Gpi-1s antikoerper, Gpi-1t antikoerper, Gpi1-r antikoerper, Gpi1-s antikoerper, Gpi1-t antikoerper, Gpi1s antikoerper, MF antikoerper, NK antikoerper, NK/GPI antikoerper, Org antikoerper, AMF antikoerper, GNPI antikoerper, NLK antikoerper, PHI antikoerper, SA-36 antikoerper, SA36 antikoerper, gpi antikoerper, pgi-2 antikoerper, glucose-6-phosphate isomerase antikoerper, gpi antikoerper, glucose-6-phosphate isomerase 1 antikoerper, gpi Glucose-6-phosphate isomerase antikoerper, Phosphoglucose isomerase antikoerper, glucose phosphate isomerase 1 antikoerper, glucose-6-phosphate isomerase b antikoerper, GPI antikoerper, Gpi antikoerper, gpi antikoerper, pgi antikoerper, GPI1 antikoerper, Pgi antikoerper, Gpi1 antikoerper, gpib antikoerper
- Substanzklasse
- Viral Protein
- Hintergrund
-
Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.
Synonyms: AMF | Aurocrine motility factor | GNPI | GPI | Gpi1 | Neuroleukin | NLK | Oxoisomerase | PGI | PHI | SA36 | SA-36 | SA 36 | P06744 - Gen-ID
- 2821
- UniProt
- P06744
-