HNRNPA1 Antikörper (N-Term)

Produktnummer ABIN4886621

Produktdetails anti-HNRNPA1 Antikörper

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Bindungsspezifität: AA 8-42, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KEPEQLRKLF IGGLSFETTD ESLRSHFEQW GTLTD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heterogeneous nuclear ribonucleoprotein A1
Protein Name: Heterogeneous nuclear ribonucleoprotein A1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HNRNPA1

Target: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Andere Bezeichnung: HNRNPA1 (HNRNPA1 Produkte)

Synonyme: HNRPA1 antikoerper, HNRPA1L3 antikoerper, hnRNP A1 antikoerper, hnRNP-A1 antikoerper, hnrpa1 antikoerper, TPT1P antikoerper, HNRNPA1 antikoerper, D15Ertd119e antikoerper, Hdp antikoerper, Hnrpa1 antikoerper, hnrnp-A1 antikoerper, ROA1 antikoerper, zgc:66127 antikoerper, heterogeneous nuclear ribonucleoprotein A1 antikoerper, heterogeneous nuclear ribonucleoprotein A1b antikoerper, Heterogeneous nuclear ribonucleoprotein A1 antikoerper, heterogeneous nuclear ribonucleoprotein A1 S homeolog antikoerper, ribonucleoprotein A1a antikoerper, heterogeneous nuclear ribonucleoprotein A1-like antikoerper, heterogeneous nuclear ribonucleoprotein A1a antikoerper, HNRNPA1 antikoerper, hnrnpa1b antikoerper, LOC100101226 antikoerper, roa1 antikoerper, Hnrnpa1 antikoerper, hnrnpa1.S antikoerper, hnrnpa1 antikoerper, LOC100359118 antikoerper, hnrnpa1a antikoerper

Hintergrund: Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

Synonyms: ALS19 | ALS20 | HNRNPA 1 | HNRNPA1 | hnRNP A1 | HNRPA1 | UP 1 | IBMPFD3 | HNRPA1L3 | P09651

Gen-ID: 3178

UniProt: P09651