ITLN1/Omentin Antikörper (N-Term)

Produktnummer ABIN4886644

Produktdetails anti-ITLN1/Omentin Antikörper

Target: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Bindungsspezifität: AA 19-59, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITLN1/Omentin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.

Sequenz: TDEANTYFKE WTCSSSPSLP RSCKEIKDEC PSAFDGLYFL R

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.
Gene Name: intelectin 1
Protein Name: Intelectin-1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ITLN1/Omentin

Target: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Andere Bezeichnung: ITLN1 (ITLN1 Produkte)

Synonyme: IntL antikoerper, Itln antikoerper, Itln2 antikoerper, Itln5 antikoerper, Itlna antikoerper, Lfr antikoerper, HL-1 antikoerper, HL1 antikoerper, INTL antikoerper, ITLN antikoerper, LFR antikoerper, hIntL antikoerper, omentin antikoerper, LfR antikoerper, Xeel antikoerper, hl-1 antikoerper, hl1 antikoerper, intl antikoerper, itln antikoerper, itln1 antikoerper, lfr antikoerper, xeel antikoerper, INTL1 antikoerper, zgc:153267 antikoerper, intelectin 1 (galactofuranose binding) antikoerper, intelectin 1 antikoerper, intelectin 1 L homeolog antikoerper, Itln1 antikoerper, ITLN1 antikoerper, itln1.L antikoerper, itln1 antikoerper

Hintergrund: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.

Synonyms: Endothelial lectin HL 1 | Endothelial lectin HL-1 | hIntL | HL1 | HL 1 | Intelectin | Intelectin-1 | Intelectin 1 | INTL | ITLN | ITLN-1 | ITLN1 | LFR | Omentin | Q8WWA0

Gen-ID: 55600