LRIG3 Antikörper (Middle Region)
-
- Target Alle LRIG3 Antikörper anzeigen
- LRIG3 (Leucine-Rich Repeats and Immunoglobulin-Like Domains 3 (LRIG3))
-
Bindungsspezifität
- AA 428-465, Middle Region
- Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRIG3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human,Rat.
- Sequenz
- NAFSQMKKLQ QLHLNTSSLL CDCQLKWLPQ WVAENNFQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human,Rat.
Gene Name: leucine rich repeats and immunoglobulin like domains 3
Protein Name: Leucine-rich repeats and immunoglobulin-like domains protein 3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product LRIG3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- LRIG3 (Leucine-Rich Repeats and Immunoglobulin-Like Domains 3 (LRIG3))
- Andere Bezeichnung
- LRIG3 (LRIG3 Produkte)
- Synonyme
- LRIG3 antikoerper, lrig3 antikoerper, GB17149 antikoerper, LIG3 antikoerper, 9030421L11Rik antikoerper, 9130004I02Rik antikoerper, 9430095K15Rik antikoerper, mKIAA3016 antikoerper, RGD1561255 antikoerper, leucine rich repeats and immunoglobulin like domains 3 antikoerper, leucine-rich repeats and immunoglobulin-like domains 3 antikoerper, leucine-rich repeats and immunoglobulin-like domains protein 3 antikoerper, leucine-rich repeats and immunoglobulin like domains 3 S homeolog antikoerper, leucine-rich repeats and immunoglobulin like domains 3 antikoerper, LRIG3 antikoerper, lrig3 antikoerper, LOC726128 antikoerper, lrig3.S antikoerper, Lrig3 antikoerper
- Hintergrund
-
LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8 % and 54.0 % amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.
Synonyms: LIG-3 | LIG3 | LRIG1-3 | Lrig3 | Q6UXM1 - Gen-ID
- 121227
-