PA2G4 Antikörper (C-Term)
-
- Target Alle PA2G4 Antikörper anzeigen
- PA2G4 (Proliferation-Associated 2G4, 38kDa (PA2G4))
-
Bindungsspezifität
- AA 138-178, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PA2G4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- RKADVIKAAH LCAEAALRLV KPGNQNTQVT EAWNKVAHSF N
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proliferation-associated 2G4
Protein Name: Proliferation-associated protein 2G4 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product PA2G4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PA2G4 (Proliferation-Associated 2G4, 38kDa (PA2G4))
- Andere Bezeichnung
- PA2G4 (PA2G4 Produkte)
- Synonyme
- EBP1 antikoerper, HG4-1 antikoerper, p38-2G4 antikoerper, Ebp1 antikoerper, pa2g4 antikoerper, si:dz150i12.2 antikoerper, wu:fb19b11 antikoerper, wu:ft56d05 antikoerper, zgc:86732 antikoerper, ebp1 antikoerper, hg4-1 antikoerper, p38-2g4 antikoerper, pa2g4-a antikoerper, PA2G4 antikoerper, DKFZp469G2132 antikoerper, Pa2g4 antikoerper, MGC81621 antikoerper, 38kDa antikoerper, AA672939 antikoerper, Plfap antikoerper, proliferation-associated 2G4 antikoerper, proliferation-associated 2G4, a antikoerper, proliferation-associated 2G4, 38kDa antikoerper, proliferation-associated 2G4 L homeolog antikoerper, proliferation-associated protein 2G4 antikoerper, proliferation-associated 2G4 S homeolog antikoerper, proliferation-associated protein 2G4 pseudogene antikoerper, PA2G4 antikoerper, Pa2g4 antikoerper, pa2g4a antikoerper, pa2g4.L antikoerper, pa2g4 antikoerper, LOC100519773 antikoerper, pa2g4.S antikoerper, LOC693641 antikoerper
- Hintergrund
-
Proliferation-associated protein 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional corepressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases.
Synonyms: hG4 1 | hG4-1 | Mpp1 | p38 2G4 | Pa2g4 | Plfap | Q9UQ80 - Gen-ID
- 5036
- Pathways
- Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Toll-Like Receptors Cascades
-