PSMA2 Antikörper (Middle Region)
-
- Target Alle PSMA2 Antikörper anzeigen
- PSMA2 (Proteasome Subunit alpha 2 (PSMA2))
-
Bindungsspezifität
- AA 82-123, Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.
- Sequenz
- DYRVLVHRAR KLAQQYYLVY QEPIPTAQLV QRVASVMQEY T
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human,Rat.
Gene Name: proteasome subunit alpha 2
Protein Name: Proteasome subunit alpha type-2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product PSMA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PSMA2 (Proteasome Subunit alpha 2 (PSMA2))
- Andere Bezeichnung
- PSMA2 (PSMA2 Produkte)
- Synonyme
- Lmpc3 antikoerper, wu:faa49c06 antikoerper, wu:fb98h03 antikoerper, zgc:110710 antikoerper, HC3 antikoerper, MU antikoerper, PMSA2 antikoerper, PSC2 antikoerper, proteasome (prosome, macropain) subunit, alpha type 2 antikoerper, proteasome subunit alpha 2 antikoerper, proteasome subunit alpha 2 L homeolog antikoerper, Psma2 antikoerper, psma2 antikoerper, psma2.L antikoerper, PSMA2 antikoerper
- Hintergrund
-
Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
Synonyms: HC3 | MU | PMSA2 | PSC2 | PSC3 | PSMA 2 | PSMA2 | P25787 - Gen-ID
- 5683
- UniProt
- P25787
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-