TLN2 Antikörper (Middle Region)

Produktnummer ABIN4886745

Produktdetails anti-TLN2 Antikörper

Target: TLN2 (Talin 2 (TLN2))

Bindungsspezifität: AA 1787-1822, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TLN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: NPKAQHTHDA ITEAAQLMKE AVDDIMVTLN EAASEV

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: talin 2
Protein Name: Talin-2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-TLN2 Antikörper (ABIN4886745)

Li, Li, Qi, Rychahou, Jafari, Huang: "The role of talin2 in breast cancer tumorigenesis and metastasis." in: Oncotarget, Vol. 8, Issue 63, pp. 106876-106887, (2017) (PubMed).

Details zu TLN2

Target: TLN2 (Talin 2 (TLN2))

Andere Bezeichnung: TLN2 (TLN2 Produkte)

Synonyme: TLN2 antikoerper, ilweq antikoerper, talin-2 antikoerper, ILWEQ antikoerper, 5730421P04Rik antikoerper, AI507121 antikoerper, AI787438 antikoerper, AL118320 antikoerper, mKIAA0320 antikoerper, RGD1565416 antikoerper, talin 2 antikoerper, talin 2 S homeolog antikoerper, TLN2 antikoerper, tln2.S antikoerper, tln2 antikoerper, Tln2 antikoerper

Hintergrund: Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.

Synonyms: Talin2 | Talin 2 | Talin-2 | TLN2 | TLN 2 | TLN-2 | ILWEQ | Q9Y4G6

Gen-ID: 83660

UniProt: Q9Y4G6

Pathways: Cell-Cell Junction Organization, Maintenance of Protein Location