TLN2 Antikörper (Middle Region)
-
- Target Alle TLN2 Antikörper anzeigen
- TLN2 (Talin 2 (TLN2))
-
Bindungsspezifität
- AA 1787-1822, Middle Region
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TLN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- NPKAQHTHDA ITEAAQLMKE AVDDIMVTLN EAASEV
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: talin 2
Protein Name: Talin-2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).
- Isotyp
- IgG
- Top Product
- Discover our top product TLN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
The role of talin2 in breast cancer tumorigenesis and metastasis." in: Oncotarget, Vol. 8, Issue 63, pp. 106876-106887, (2017) (PubMed).
: "
-
The role of talin2 in breast cancer tumorigenesis and metastasis." in: Oncotarget, Vol. 8, Issue 63, pp. 106876-106887, (2017) (PubMed).
-
- Target
- TLN2 (Talin 2 (TLN2))
- Andere Bezeichnung
- TLN2 (TLN2 Produkte)
- Hintergrund
-
Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.
Synonyms: Talin2 | Talin 2 | Talin-2 | TLN2 | TLN 2 | TLN-2 | ILWEQ | Q9Y4G6 - Gen-ID
- 83660
- UniProt
- Q9Y4G6
- Pathways
- Cell-Cell Junction Organization, Maintenance of Protein Location
-