TUBB3 Antikörper (C-Term)

Produktnummer ABIN4886757

Produktdetails anti-TUBB3 Antikörper

Target: TUBB3 (Tubulin, beta 3 (TUBB3))

Bindungsspezifität: AA 383-412, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EQFTAMFRRK AFLHWYTGEG MDEMEFTEAE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tubulin beta 3 class III
Protein Name: Tubulin beta-3 chain

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-TUBB3 Antikörper (ABIN4886757)

Qu, Zhang, Du, Wang, Yang, Guo, Wang, Zhang, Xu: "Pim-3 is a Critical Risk Factor in Development and Prognosis of Prostate Cancer." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 4254-4260, (2017) (PubMed).

Zhu, Liu, Wang, Nie, He, Zhang, Liu, Su: "Lentiviral-mediated growth-associated protein-43 modification of bone marrow mesenchymal stem cells improves traumatic optic neuropathy in rats." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 5691-700, (2016) (PubMed).

Cao, Li, Li, Xiong, Zhou, Fan, Yu, Mao: "The potential role of HMGB1 release in peritoneal dialysis-related peritonitis." in: PLoS ONE, Vol. 8, Issue 1, pp. e54647, (2013) (PubMed).

Details zu TUBB3

Target: TUBB3 (Tubulin, beta 3 (TUBB3))

Andere Bezeichnung: TUBB3 (TUBB3 Produkte)

Synonyme: CDCBM antikoerper, CFEOM3A antikoerper, TUBB4 antikoerper, beta-4 antikoerper, TUBB3 antikoerper, 3200002H15Rik antikoerper, M(beta)3 antikoerper, M(beta)6 antikoerper, tubb3 antikoerper, tubulin beta 3 class III antikoerper, tubulin, beta 3 class III antikoerper, tubulin beta 3 class III L homeolog antikoerper, beta-tubulin 3 antikoerper, tubulin beta-3 chain antikoerper, beta tubulin 3 antikoerper, TUBB3 antikoerper, Tubb3 antikoerper, tubb3 antikoerper, tubb3.L antikoerper, LOC100581245 antikoerper, tub3 antikoerper

Hintergrund: Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

Synonyms: beta 3 tubulin | beta-4 | CDCBM | CDCBM1 | CFEOM3A | CFEOM3 | FEOM3 | M(beta)3 | M(beta)6 | MC1R | Tubb 3 | TUBB3 | TUBB4 | Tubulin beta 3 | Tubulin beta 3 chain | Tubulin beta 4 | Tubulin beta-4 chain | Tubulin beta III | Tubulin beta-III | Q13509

Gen-ID: 10381

UniProt: Q13509

Pathways: Microtubule Dynamics, M Phase