VASP Antikörper (N-Term)

Produktnummer ABIN4886759

Produktdetails anti-VASP Antikörper

Target: VASP (Vasodilator-Stimulated phosphoprotein (VASP))

Bindungsspezifität: AA 78-114, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VASP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Vasodilator-stimulated phosphoprotein(VASP) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: NFHQWRDARQ VWGLNFGSKE DAAQFAAGMA SALEALE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Vasodilator-stimulated phosphoprotein(VASP) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: vasodilator-stimulated phosphoprotein
Protein Name: Vasodilator-stimulated phosphoprotein

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human VASP (78-114aa NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu VASP

Target: VASP (Vasodilator-Stimulated phosphoprotein (VASP))

Andere Bezeichnung: VASP (VASP Produkte)

Synonyme: vasp antikoerper, MGC80889 antikoerper, wu:fb23b04 antikoerper, wu:fk84g05 antikoerper, zgc:110347 antikoerper, si:dkey-113g17.1 antikoerper, si:ch211-202c21.1 antikoerper, DDBDRAFT_0188463 antikoerper, DDBDRAFT_0229340 antikoerper, DDB_0188463 antikoerper, DDB_0229340 antikoerper, VASP antikoerper, vasodilator stimulated phosphoprotein S homeolog antikoerper, vasodilator stimulated phosphoprotein b antikoerper, protein enabled antikoerper, vasodilator-stimulated phosphoprotein antikoerper, vasodilator stimulated phosphoprotein a antikoerper, vasodilator stimulated phosphoprotein antikoerper, vasp.S antikoerper, vaspb antikoerper, LOC5573842 antikoerper, CpipJ_CPIJ004706 antikoerper, CpipJ_CPIJ004707 antikoerper, vasP antikoerper, vasp antikoerper, VASP antikoerper, vaspa antikoerper, Vasp antikoerper

Hintergrund: Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG.

Synonyms: VASP | P50552

Gen-ID: 7408

UniProt: P50552

Pathways: T-Zell Rezeptor Signalweg, Regulation of Actin Filament Polymerization, Tube Formation