ATG14 Antikörper
-
- Target Alle ATG14 Antikörper anzeigen
- ATG14 (ATG14 Autophagy Related 14 (ATG14))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATG14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ATG14 Primärantikörper
-
anti-ATG14 Autophagy Related 14 (ATG14) (AA 43-303) antibody
ATG14 Reaktivität: Human WB, ELISA, IHC, FACS, ICC Wirt: Maus Monoclonal 1F7C10 unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) (AA 1-492) antibodyATG14 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) (AA 1-310) antibodyATG14 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) (AA 55-84), (N-Term) antibodyATG14 Reaktivität: Human, Maus WB, FACS Wirt: Kaninchen Polyclonal RB19669 unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) (AA 162-190) antibodyATG14 Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB19671 unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) (AA 70-101), (N-Term) antibodyATG14 Reaktivität: Human, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) (AA 1-310) antibodyATG14 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-ATG14 Autophagy Related 14 (ATG14) antibodyATG14 Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal dilution of the ATG14L antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the ATG14L antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ATG14 (ATG14 Autophagy Related 14 (ATG14))
- Andere Bezeichnung
- ATG14L (ATG14 Produkte)
- Synonyme
- ATG14L antikoerper, BARKOR antikoerper, KIAA0831 antikoerper, 4832427M01 antikoerper, Atg14L antikoerper, D14Ertd114e antikoerper, D14Ertd436e antikoerper, RGD1304610 antikoerper, autophagy related 14 antikoerper, ATG14 antikoerper, Atg14 antikoerper
- Hintergrund
- ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.
- UniProt
- Q6ZNE5
- Pathways
- Autophagie
-
