BMP5 Antikörper
-
- Target Alle BMP5 Antikörper anzeigen
- BMP5 (Bone Morphogenetic Protein 5 (BMP5))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BMP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product BMP5 Primärantikörper
-
anti-Bone Morphogenetic Protein 5 (BMP5) antibody
BMP5 Reaktivität: Human, Maus, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 317-454) antibodyBMP5 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibodyBMP5 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 16-46), (N-Term) antibodyBMP5 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB1859 unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 1-454) antibodyBMP5 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 323-454) antibodyBMP5 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1G6 unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 323-422) antibodyBMP5 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1G6 unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 201-314) antibodyBMP5 Reaktivität: Maus WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 315-452) antibodyBMP5 Reaktivität: Maus WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Bone Morphogenetic Protein 5 (BMP5) (AA 16-46) antibodyBMP5 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal dilution of the BMP5 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,ELISA: 0.1-0.5 μg/mL (human protein tested)
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the BMP5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- BMP5 (Bone Morphogenetic Protein 5 (BMP5))
- Andere Bezeichnung
- BMP5 (BMP5 Produkte)
- Hintergrund
- Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.
- UniProt
- P22003
- Pathways
- Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process
-
