CPT1B Antikörper
-
- Target Alle CPT1B Antikörper anzeigen
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPT1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product CPT1B Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the CPT1B antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the CPT1B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))
- Andere Bezeichnung
- CPT1B (CPT1B Produkte)
- Synonyme
- CPT1-M antikoerper, CPT1M antikoerper, CPTI antikoerper, CPTI-M antikoerper, M-CPT1 antikoerper, MCCPT1 antikoerper, MCPT1 antikoerper, CPT-IB antikoerper, M-CPTI antikoerper, CPT1 antikoerper, CPTIB antikoerper, cpt1al antikoerper, zgc:103709 antikoerper, CPT1B antikoerper, MGC147544 antikoerper, Cpt1 antikoerper, Cpt1-m antikoerper, Cpti antikoerper, Cpti-m antikoerper, M-cpti antikoerper, carnitine palmitoyltransferase 1B antikoerper, carnitine palmitoyltransferase 1B (muscle) antikoerper, carnitine palmitoyltransferase 1B L homeolog antikoerper, carnitine palmitoyltransferase 1b, muscle antikoerper, CPT1B antikoerper, Cpt1b antikoerper, cpt1b antikoerper, cpt1b.L antikoerper
- Hintergrund
- CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
- UniProt
- Q92523
- Pathways
- AMPK Signaling, Monocarboxylic Acid Catabolic Process
-