EWSR1 Antikörper
-
- Target Alle EWSR1 Antikörper anzeigen
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EWSR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product EWSR1 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the EWSR1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 1-2 μg/mL,ICC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the EWSR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
- Andere Bezeichnung
- EWS / EWSR1 (EWSR1 Produkte)
- Synonyme
- EWS antikoerper, bK984G1.4 antikoerper, AU018891 antikoerper, Ews antikoerper, Ewsh antikoerper, EWSR1 antikoerper, fc04c01 antikoerper, wu:fc04c01 antikoerper, DKFZp459K1116 antikoerper, ewsr1 antikoerper, ewsr1.S antikoerper, fb40b11 antikoerper, fusl antikoerper, wu:fb40b11 antikoerper, wu:fb75g09 antikoerper, zgc:55864 antikoerper, EWS RNA binding protein 1 antikoerper, Ewing sarcoma breakpoint region 1 antikoerper, EWS RNA-binding protein 1 antikoerper, EWS RNA-binding protein 1a antikoerper, EWS RNA binding protein 1 L homeolog antikoerper, EWS RNA-binding protein 1b antikoerper, EWSR1 antikoerper, Ewsr1 antikoerper, ewsr1a antikoerper, ewsr1 antikoerper, ewsr1.L antikoerper, ewsr1b antikoerper
- Hintergrund
- This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
- UniProt
- Q01844
-