GNAQ Antikörper
-
- Target Alle GNAQ Antikörper anzeigen
- GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNAQ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product GNAQ Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the GNAQ antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the GNAQ antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))
- Andere Bezeichnung
- GNAQ (GNAQ Produkte)
- Synonyme
- si:ch73-270f14.2 antikoerper, CMC1 antikoerper, G-ALPHA-q antikoerper, GAQ antikoerper, SWS antikoerper, Galphaq antikoerper, Gnaq antikoerper, g-alpha-q antikoerper, gaq antikoerper, gnaqb antikoerper, 1110005L02Rik antikoerper, 6230401I02Rik antikoerper, AA408290 antikoerper, AW060788 antikoerper, Dsk1 antikoerper, Dsk10 antikoerper, Gq antikoerper, GqI antikoerper, guanine nucleotide binding protein (G protein), q polypeptide antikoerper, G protein subunit alpha q antikoerper, guanine nucleotide binding protein (G protein), q polypeptide S homeolog antikoerper, guanine nucleotide binding protein, alpha q polypeptide antikoerper, gnaq antikoerper, GNAQ antikoerper, Gnaq antikoerper, gnaq.S antikoerper
- Hintergrund
- Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.
- UniProt
- P50148
- Pathways
- JAK-STAT Signalweg, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction
-