GREM1 Antikörper
-
- Target Alle GREM1 Antikörper anzeigen
- GREM1 (Gremlin 1 (GREM1))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GREM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product GREM1 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- GREM1 (Gremlin 1 (GREM1))
- Andere Bezeichnung
- Gremlin 1 (GREM1 Produkte)
- Synonyme
- grem1 antikoerper, MGC136702 antikoerper, zgc:136702 antikoerper, GREM1 antikoerper, drm antikoerper, pig2 antikoerper, dand2 antikoerper, ihg-2 antikoerper, gremlin antikoerper, Cktsf1b1 antikoerper, Drm antikoerper, Grem antikoerper, ld antikoerper, gremlin-1 antikoerper, CKTSF1B1 antikoerper, DAND2 antikoerper, DRM antikoerper, GREMLIN antikoerper, IHG-2 antikoerper, cktsf1b1 antikoerper, gremlin 1a, DAN family BMP antagonist antikoerper, gremlin 1, DAN family BMP antagonist antikoerper, gremlin 1 antikoerper, gremlin 1, DAN family BMP antagonist L homeolog antikoerper, grem1a antikoerper, GREM1 antikoerper, LOC662541 antikoerper, grem1 antikoerper, Grem1 antikoerper, grem1.L antikoerper
- Hintergrund
- Gremlin, also known as Drm, is a highly conserved 20.7- kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
- UniProt
- O60565
- Pathways
- Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location
-