HRAS Antikörper

Produktnummer ABIN4951352

Produktdetails anti-HRAS Antikörper

Target: HRAS (HRas proto-oncogene, GTPase (HRAS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HRAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HRAS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HRAS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HRAS

Target: HRAS (HRas proto-oncogene, GTPase (HRAS))

Andere Bezeichnung: HRAS (HRAS Produkte)

Hintergrund: GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

UniProt: P01112

Pathways: p53 Signalweg, MAPK Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hepatitis C, Autophagie, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling