Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

HRAS Antikörper

HRAS Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN4951352
  • Target Alle HRAS Antikörper anzeigen
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Reaktivität
    • 67
    • 52
    • 37
    • 7
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 89
    • 10
    • 1
    Kaninchen
    Klonalität
    • 89
    • 11
    Polyklonal
    Konjugat
    • 42
    • 11
    • 10
    • 6
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Dieser HRAS Antikörper ist unkonjugiert
    Applikation
    • 90
    • 43
    • 26
    • 26
    • 16
    • 15
    • 10
    • 9
    • 7
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Aufreinigung
    Antigen affinity
    Immunogen
    Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.
    Isotyp
    IgG
    Top Product
    Discover our top product HRAS Primärantikörper
  • Applikationshinweise
    Optimal dilution of the HRAS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Lagerung
    -20 °C
    Informationen zur Lagerung
    After reconstitution, the HRAS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Andere Bezeichnung
    HRAS (HRAS Produkte)
    Synonyme
    C-BAS/HAS antikoerper, C-H-RAS antikoerper, C-HA-RAS1 antikoerper, CTLO antikoerper, H-RASIDX antikoerper, HAMSV antikoerper, HRAS1 antikoerper, K-RAS antikoerper, N-RAS antikoerper, RASH1 antikoerper, hras antikoerper, zgc:110250 antikoerper, HRAS antikoerper, H-RAS antikoerper, c-H-ras antikoerper, H-Ras antikoerper, K-Ras antikoerper, hras1 antikoerper, rash1 antikoerper, ras antikoerper, N-Ras antikoerper, c-bas/has antikoerper, H-ras antikoerper, Ha-ras antikoerper, Harvey-ras antikoerper, Hras-1 antikoerper, Kras2 antikoerper, c-Ha-ras antikoerper, c-rasHa antikoerper, hrasl antikoerper, zgc:110734 antikoerper, HRas proto-oncogene, GTPase antikoerper, v-Ha-ras Harvey rat sarcoma viral oncogene homolog a antikoerper, neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene antikoerper, Harvey rat sarcoma viral oncogene homolog L homeolog antikoerper, Harvey rat sarcoma viral oncogene homolog antikoerper, Harvey rat sarcoma virus oncogene antikoerper, NRAS proto-oncogene, GTPase antikoerper, -Ha-ras Harvey rat sarcoma viral oncogene homolog b antikoerper, HRAS antikoerper, hrasa antikoerper, LOC733587 antikoerper, Hras antikoerper, hras.L antikoerper, hras antikoerper, NRAS antikoerper, hrasb antikoerper
    Hintergrund
    GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
    UniProt
    P01112
    Pathways
    p53 Signalweg, MAPK Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hepatitis C, Autophagie, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling
Sie sind hier:
Kundenservice