ICA1 Antikörper
-
- Target Alle ICA1 Antikörper anzeigen
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ICA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ICA1 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the ICA1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))
- Andere Bezeichnung
- ICA1 (ICA1 Produkte)
- Synonyme
- ica1 antikoerper, MGC52730 antikoerper, ICA1 antikoerper, DKFZp469G0321 antikoerper, zgc:92566 antikoerper, 69kDa antikoerper, ICA69 antikoerper, Ica69 antikoerper, MGC83241 antikoerper, ICAp69 antikoerper, islet cell autoantigen 1 L homeolog antikoerper, islet cell autoantigen 1 antikoerper, Islet cell autoantigen 1 antikoerper, islet cell autoantigen 1 S homeolog antikoerper, ica1.L antikoerper, ICA1 antikoerper, ica1 antikoerper, ica69 antikoerper, Ica1 antikoerper, ica1.S antikoerper
- Hintergrund
- Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
- UniProt
- Q05084
-