LOXL2 Antikörper
-
- Target Alle LOXL2 Antikörper anzeigen
- LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LOXL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ of human Lysyl oxidase homolog 2 were used as the immunogen for the LOXL2 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product LOXL2 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the LOXL2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the LOXL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))
- Andere Bezeichnung
- LOXL2 (LOXL2 Produkte)
- Synonyme
- LOR2 antikoerper, WS9-14 antikoerper, CG4402 antikoerper, Dmel\\CG4402 antikoerper, Dmloxl-2 antikoerper, dmlox-2 antikoerper, 1110004B06Rik antikoerper, 4930526G11Rik antikoerper, 9430067E15Rik antikoerper, GB13360 antikoerper, lox2-like antikoerper, LOXL2 antikoerper, lor2 antikoerper, loxl-2 antikoerper, ws9-14 antikoerper, im:7136137 antikoerper, si:dkeyp-32b1.1 antikoerper, wu:fk12g04 antikoerper, zgc:158414 antikoerper, lysyl oxidase like 2 antikoerper, lysyl oxidase-like 2 antikoerper, lysyl oxidase homolog 4 antikoerper, lysyl oxidase like 2 L homeolog antikoerper, lysyl oxidase-like 2b antikoerper, LOXL2 antikoerper, lox2 antikoerper, Loxl2 antikoerper, LOC408544 antikoerper, loxl2.L antikoerper, loxl2 antikoerper, loxl2b antikoerper
- Hintergrund
- Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.
- UniProt
- Q9Y4K0
- Pathways
- Chromatin Binding
-