PAX2A Antikörper
-
- Target Alle PAX2A Antikörper anzeigen
- PAX2A (Paired Box Gene 2a (PAX2A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAX2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH of human PAX2 were used as the immunogen for the PAX2 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product PAX2A Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the PAX2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the PAX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- PAX2A (Paired Box Gene 2a (PAX2A))
- Andere Bezeichnung
- PAX2 (PAX2A Produkte)
- Synonyme
- PAPRS antikoerper, Opdc antikoerper, Pax-2 antikoerper, Pax-2a antikoerper, XPax-2 antikoerper, XPax2 antikoerper, pax-2 antikoerper, pax2 antikoerper, xPax-2a antikoerper, PAXZF-B antikoerper, cb378 antikoerper, noi antikoerper, pax-b antikoerper, pax2.1 antikoerper, pax2a1 antikoerper, pax[zf-b] antikoerper, paxb antikoerper, pax2.2 antikoerper, paired box 2 antikoerper, paired box 2 L homeolog antikoerper, paired box 2a antikoerper, paired box 2b antikoerper, PAX2 antikoerper, Pax2 antikoerper, pax2.L antikoerper, pax2a antikoerper, pax2b antikoerper
- Hintergrund
- The PAX2 gene encodes Paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
- UniProt
- Q02962
- Pathways
- Carbohydrate Homeostasis, Stem Cell Maintenance, Tube Formation
-