UBA3 Antikörper
-
- Target Alle UBA3 Antikörper anzeigen
- UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD of human UBE1C/UBA3 were used as the immunogen for the UBE1C antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product UBA3 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the UBE1C antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the UBE1C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))
- Andere Bezeichnung
- UBE1C / UBA3 (UBA3 Produkte)
- Synonyme
- UBE1C antikoerper, hUBA3 antikoerper, Ube1c antikoerper, ube1c antikoerper, wu:fb75e04 antikoerper, wu:fc37b11 antikoerper, zgc:55528 antikoerper, A830034N06Rik antikoerper, AI256736 antikoerper, AI848246 antikoerper, AW546539 antikoerper, ubiquitin like modifier activating enzyme 3 antikoerper, ubiquitin-like modifier activating enzyme 3 antikoerper, ubiquitin like modifier activating enzyme 3 S homeolog antikoerper, UBA3 antikoerper, Uba3 antikoerper, uba3 antikoerper, uba3.S antikoerper
- Hintergrund
- NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- UniProt
- Q8TBC4
-