POLQ Antikörper (C-Term)

Produktnummer ABIN5515979

Produktdetails anti-POLQ Antikörper

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Sequenz: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL

Homologie: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 93%, Human: 100%, Mouse: 93%, Rabbit: 86%, Rat: 100%

Produktmerkmale: This is a rabbit polyclonal antibody against POLQ. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (< a href="mailto:info@avivasysbio.com">info@avivasysbio.com).

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Details zu POLQ

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Andere Bezeichnung: POLQ (POLQ Produkte)

Synonyme: POLH antikoerper, PRO0327 antikoerper, A430110D14Rik antikoerper, DNA polymerase theta antikoerper, polymerase (DNA directed), theta antikoerper, POLQ antikoerper, polq antikoerper, LOC100179525 antikoerper, Polq antikoerper

Hintergrund: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Alias Symbols: DKFZp781A0112, POLH, PRO0327

Protein Interaction Partner: AP2S1,

Protein Size: 1762

Gen-ID: 10721

UniProt: O75417