ABCG8 Antikörper (Middle Region)
-
- Target Alle ABCG8 Antikörper anzeigen
- ABCG8 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 8 (ABCG8))
-
Bindungsspezifität
- AA 328-371, Middle Region
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCG8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 8(ABCG8) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- DRRSREQELA TREKAQSLAA LFLEKVRDLD DFLWKAETKD LDED
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 8(ABCG8) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ATP binding cassette subfamily G member 8
Protein Name: ATP-binding cassette sub-family G member 8 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ABCG8 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ABCG8 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 8 (ABCG8))
- Andere Bezeichnung
- ABCG8 (ABCG8 Produkte)
- Synonyme
- DDBDRAFT_0167690 antikoerper, DDBDRAFT_0191232 antikoerper, DDB_0167690 antikoerper, DDB_0191232 antikoerper, zgc:172358 antikoerper, GBD4 antikoerper, STSL antikoerper, 1300003C16Rik antikoerper, AI114946 antikoerper, sterolin-2 antikoerper, ATP binding cassette subfamily G member 8 antikoerper, ATP-binding cassette sub-family G member 8 antikoerper, ABC transporter G family protein antikoerper, ATP-binding cassette, sub-family G (WHITE), member 8 antikoerper, ABCG8 antikoerper, PTRG_02054 antikoerper, abcG8 antikoerper, abcg8 antikoerper, Abcg8 antikoerper
- Hintergrund
-
ATP-binding cassette sub-family G member 8 is a protein that in humans is encoded by the ABCG8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia.
Synonyms: ABCG8 | GBD4 | Sterolin 2 | Sterolin-2 | TSL | Q9H221 - Gen-ID
- 64241
- UniProt
- Q9H221
- Pathways
- Lipid Metabolism
-