alpha Defensin 1 Antikörper (C-Term)

Produktnummer ABIN5518754

Produktdetails anti-alpha Defensin 1 Antikörper

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Bindungsspezifität: AA 65-94, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser alpha Defensin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human,Rat.

Sequenz: ACYCRIPACI AGERRYGTCI YQGRLWAFCC

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human,Rat.
Gene Name: defensin alpha 1
Protein Name: Neutrophil defensin 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu alpha Defensin 1

Target: alpha Defensin 1 (DEFA1) (Defensin, alpha 1 (DEFA1))

Andere Bezeichnung: DEFA1 (DEFA1 Produkte)

Synonyme: DEF1 antikoerper, DEFA2 antikoerper, HNP-1 antikoerper, HP-1 antikoerper, HP1 antikoerper, MRS antikoerper, Defcr antikoerper, Defcr1 antikoerper, DEFA1 antikoerper, Defa antikoerper, Def antikoerper, GB19392 antikoerper, defensin alpha 1 antikoerper, defensin, alpha 1 antikoerper, defensin alpha 5 antikoerper, alpha-defensin 1A antikoerper, defensin 1 antikoerper, neutrophil defensin 1 antikoerper, DEFA1 antikoerper, Defa1 antikoerper, Defa5 antikoerper, MNP1A antikoerper, Def1 antikoerper, LOC107973256 antikoerper

Hintergrund: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

Synonyms: DEF1 | DEFA1 | DEFA1B | DEFA2 | Defensin 1 | Defensin | HNP-1 | HNP-2 | HNP1 | HP-1 | HP-2 | HP1 | HP2 | MRS | P59665

Gen-ID: 1667

UniProt: P59665

Pathways: Cellular Response to Molecule of Bacterial Origin