Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

HMGB1 Antikörper (C-Term)

HMGB1 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5518759
  • Target Alle HMGB1 Antikörper anzeigen
    HMGB1 (High Mobility Group Box 1 (HMGB1))
    Bindungsspezifität
    • 21
    • 16
    • 16
    • 11
    • 9
    • 8
    • 6
    • 6
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 124-154, C-Term
    Reaktivität
    • 153
    • 89
    • 88
    • 13
    • 11
    • 11
    • 10
    • 8
    • 6
    • 6
    • 6
    • 6
    • 5
    • 2
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 131
    • 32
    • 2
    • 2
    • 1
    • 1
    Kaninchen
    Klonalität
    • 122
    • 47
    Polyklonal
    Konjugat
    • 86
    • 17
    • 16
    • 8
    • 6
    • 6
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser HMGB1 Antikörper ist unkonjugiert
    Applikation
    • 139
    • 62
    • 47
    • 45
    • 31
    • 29
    • 27
    • 26
    • 20
    • 10
    • 9
    • 5
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Verwendungszweck
    Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequenz
    DVAKKLGEMW NNTAADDKQP YEKKAAKLKE K
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: high mobility group box 1
    Protein Name: High mobility group protein B1
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
    Isotyp
    IgG
    Top Product
    Discover our top product HMGB1 Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Lagerung
    4 °C,-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Jia, Sun, Hu, Li, Ruan: "Propofol inhibits the release of interleukin-6, 8 and tumor necrosis factor-α correlating with high-mobility group box 1 expression in lipopolysaccharides-stimulated RAW 264.7 cells." in: BMC anesthesiology, Vol. 17, Issue 1, pp. 148, (2018) (PubMed).

    Ruisong, Xiaorong, Gangying, Chunfeng, Changjiang, Xuefei, Yuanhong, Hong: "The Protective Role of Interleukin-33 in Myocardial Ischemia and Reperfusion Is Associated with Decreased HMGB1 Expression and Up-Regulation of the P38 MAPK Signaling Pathway." in: PLoS ONE, Vol. 10, Issue 11, pp. e0143064, (2016) (PubMed).

    Li, Zhou, Zhou, Zou: "Galantamine protects against lipopolysaccharide-induced acute lung injury in rats." in: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 49, Issue 2, pp. e5008, (2016) (PubMed).

    Bi, Zhu, Yan, Chen, Wang, Ma, Yang: "Association of Upregulated HMGB1 and c-IAP2 Proteins With Hepatocellular Carcinoma Development and Progression." in: Hepatitis monthly, Vol. 14, Issue 12, pp. e23552, (2015) (PubMed).

  • Target
    HMGB1 (High Mobility Group Box 1 (HMGB1))
    Andere Bezeichnung
    HMGB1 (HMGB1 Produkte)
    Synonyme
    HMG1 antikoerper, HMG3 antikoerper, SBP-1 antikoerper, DEF antikoerper, HMG-1 antikoerper, Hmg1 antikoerper, amphoterin antikoerper, p30 antikoerper, hmgb1 antikoerper, ik:tdsubc_1a5 antikoerper, wu:fb23c02 antikoerper, xx:tdsubc_1a5 antikoerper, zgc:56110 antikoerper, zgc:77104 antikoerper, hmg-1 antikoerper, hmg3 antikoerper, sbp-1 antikoerper, hmg1 antikoerper, HMGB1 antikoerper, Ac2-008 antikoerper, high mobility group box 1 antikoerper, high-mobility group box 1 antikoerper, high mobility group box 1a antikoerper, high mobility group box 1 L homeolog antikoerper, high mobility group protein B1 antikoerper, HMGB1 antikoerper, Hmgb1 antikoerper, hmgb1 antikoerper, hmgb1a antikoerper, hmgb1.L antikoerper, LOC100359149 antikoerper
    Hintergrund
    High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

    Synonyms: Amphoterin | HMG-1 | HMG1 | HMG3 | HMGB 1 | HMGB1 | SBP 1 | P09429
    Gen-ID
    3146
    UniProt
    P09429
    Pathways
    p53 Signalweg, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome
Sie sind hier:
Kundenservice