TUB Antikörper (C-Term)

Produktnummer ABIN5518797

Produktdetails anti-TUB Antikörper

Target: TUB (Tubby Homolog (TUB))

Bindungsspezifität: AA 395-429, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.

Sequenz: VHERVSIRPR NEHETLLARW QNKNTESIIE LQNKT

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tubby protein homolog(TUB) detection. Tested with WB in Human.
Gene Name: tubby bipartite transcription factor
Protein Name: Tubby protein homolog

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TUB

Target: TUB (Tubby Homolog (TUB))

Andere Bezeichnung: TUB (TUB Produkte)

Synonyme: rd5 antikoerper, tubby antikoerper, MGC79522 antikoerper, TUB antikoerper, MGC80126 antikoerper, MGC84061 antikoerper, tub antikoerper, tubby bipartite transcription factor antikoerper, tubby bipartite transcription factor S homeolog antikoerper, tub antikoerper, TUB antikoerper, tub.S antikoerper, Tub antikoerper

Hintergrund: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Synonyms: rd5 | TUB 1 | TUB | P50607

Gen-ID: 7275

UniProt: P50607

Pathways: RTK Signalweg, Sensory Perception of Sound