AMY1A, AMY1B, AMY1C (AA 20-50), (N-Term) Antikörper
-
- Target
- AMY1A, AMY1B, AMY1C
- Bindungsspezifität
- AA 20-50, N-Term
- Reaktivität
- Human, Maus, Ratte
- Wirt
- Kaninchen
- Klonalität
- Polyklonal
- Applikation
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Alpha-amylase 1(AMY1A|AMY1B|AMY1C) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- NTQQGRTSIV HLFEWRWVDI ALECERYLAP K
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Alpha-amylase 1(AMY1A|AMY1B|AMY1C) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: amylase, alpha 1A (salivary)|amylase, alpha 1B (salivary)|amylase, alpha 1C (salivary)
Protein Name: Alpha-amylase 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Isotyp
- IgG
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AMY1A, AMY1B, AMY1C
- Andere Bezeichnung
- AMY1A|AMY1B|AMY1C
- Synonyme
- AMY1 antikoerper, Amy-1 antikoerper, Amy1a antikoerper, C030014B17Rik antikoerper, Amy1 antikoerper, amylase, alpha 1C (salivary) antikoerper, amylase 1, salivary antikoerper, amylase, alpha 1A antikoerper, AMY1C antikoerper, Amy1 antikoerper, Amy1a antikoerper
- Hintergrund
-
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Synonyms: Alpha-amylase 1 | 3.2.1.1 | 1,4-alpha-D-glucan glucanohydrolase 1 | Salivary alpha-amylase | AMY1A | AMY1 | AMY1B | AMY1 | AMY1C | AMY1 | P04745 - Gen-ID
- 276, 277, 278
- UniProt
- P04745
-