MSI1 Antikörper (N-Term)

Produktnummer ABIN5518855

Produktdetails anti-MSI1 Antikörper

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Bindungsspezifität: AA 21-54, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: musashi RNA binding protein 1
Protein Name: RNA-binding protein Musashi homolog 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Andere Bezeichnung: MSI1 (MSI1 Produkte)

Synonyme: CG5099 antikoerper, DMSIDNA antikoerper, Dmel\\CG5099 antikoerper, Msi antikoerper, SIDNA antikoerper, anon-EST:Liang-2.35 antikoerper, clone 2.35 antikoerper, Msi1h antikoerper, Musashi antikoerper, Musashi-1 antikoerper, Musashi1 antikoerper, XNrp-1 antikoerper, nrp-1B antikoerper, Dsim\\GD21224 antikoerper, GD21224 antikoerper, dsim_GLEANR_4982 antikoerper, msi antikoerper, musashi antikoerper, Musahi1 antikoerper, m-Msi-1 antikoerper, msi1h antikoerper, musashi antikoerper, musashi RNA binding protein 1 antikoerper, GD21224 gene product from transcript GD21224-RD antikoerper, musashi RNA-binding protein 1 antikoerper, musashi RNA binding protein 1 S homeolog antikoerper, msi antikoerper, msi1 antikoerper, Dsim\msi antikoerper, MSI1 antikoerper, Msi1 antikoerper, msi1.S antikoerper

Hintergrund: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

Synonyms: Msi 1 | Msi1 | Musashi-1 | Musashi1 | O43347

Gen-ID: 4440

UniProt: O43347

Pathways: Stem Cell Maintenance