MSI1 Antikörper (N-Term)
-
- Target Alle MSI1 Antikörper anzeigen
- MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))
-
Bindungsspezifität
- AA 21-54, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for RNA-binding protein Musashi homolog 1(MSI1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: musashi RNA binding protein 1
Protein Name: RNA-binding protein Musashi homolog 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product MSI1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))
- Andere Bezeichnung
- MSI1 (MSI1 Produkte)
- Hintergrund
-
RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Synonyms: Msi 1 | Msi1 | Musashi-1 | Musashi1 | O43347 - Gen-ID
- 4440
- UniProt
- O43347
- Pathways
- Stem Cell Maintenance
-