RPS6 Antikörper (N-Term)

Produktnummer ABIN5518869

Produktdetails anti-RPS6 Antikörper

Target: RPS6 (Ribosomal Protein S6 (RPS6))

Bindungsspezifität: AA 13-52, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: QKLIEVDDER KLRTFYEKRM ATEVAADALG EEWKGYVVRI

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ribosomal protein S6
Protein Name: 40S ribosomal protein S6

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu RPS6

Target: RPS6 (Ribosomal Protein S6 (RPS6))

Andere Bezeichnung: RPS6 (RPS6 Produkte)

Synonyme: S6 antikoerper, rps6 antikoerper, rps6a antikoerper, S6R antikoerper, (Rp)S6 antikoerper, CG10944 antikoerper, DS6 antikoerper, Dmel\\CG10944 antikoerper, M(1)7BC antikoerper, M(1)7C antikoerper, RPS6 antikoerper, Rp S6 antikoerper, Rps6 antikoerper, air8 antikoerper, air[8] antikoerper, anon-WO02059370.61 antikoerper, hen antikoerper, l(1)air8 antikoerper, l(1)air[8] antikoerper, l(1)hen antikoerper, pp30 antikoerper, rpS6 antikoerper, wu:fa92e06 antikoerper, wu:fb64g06 antikoerper, zgc:92237 antikoerper, ribosomal protein S6 antikoerper, ribosomal protein S6 S homeolog antikoerper, S6 ribosomal protein antikoerper, Ribosomal protein S6 antikoerper, 30S ribosomal protein S6 antikoerper, 40S ribosomal protein S6 antikoerper, RPS6 antikoerper, rps6.S antikoerper, LOC100135859 antikoerper, Rps6 antikoerper, RpS6 antikoerper, rps6 antikoerper, rps-6 antikoerper, LOC100533219 antikoerper

Hintergrund: Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

Synonyms: Air8 | NP33 | Phosphoprotein NP33 | Pp30 | RP S6 | RPS6 | RS6 | S6 | P62753

Gen-ID: 6194

UniProt: P62753

Pathways: Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly