Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

EGFR Antikörper (N-Term)

EGFR Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5518909
  • Target Alle EGFR Antikörper anzeigen
    EGFR (Epidermal Growth Factor Receptor (EGFR))
    Bindungsspezifität
    • 39
    • 38
    • 31
    • 31
    • 30
    • 28
    • 27
    • 26
    • 25
    • 22
    • 21
    • 18
    • 16
    • 16
    • 16
    • 15
    • 15
    • 15
    • 11
    • 11
    • 9
    • 9
    • 9
    • 9
    • 8
    • 8
    • 7
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    AA 25-57, N-Term
    Reaktivität
    • 761
    • 298
    • 286
    • 25
    • 25
    • 24
    • 20
    • 14
    • 8
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 580
    • 178
    • 14
    • 13
    • 5
    • 4
    • 1
    • 1
    Kaninchen
    Klonalität
    • 542
    • 249
    • 2
    Polyklonal
    Konjugat
    • 415
    • 58
    • 29
    • 22
    • 20
    • 18
    • 18
    • 17
    • 16
    • 16
    • 16
    • 12
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 10
    • 8
    • 8
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser EGFR Antikörper ist unkonjugiert
    Applikation
    • 537
    • 252
    • 154
    • 151
    • 128
    • 102
    • 99
    • 93
    • 82
    • 46
    • 37
    • 34
    • 34
    • 19
    • 11
    • 8
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Verwendungszweck
    Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
    Sequenz
    LEEKKVCQGT SNKLTQLGTF EDHFLSLQRM FNN
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: epidermal growth factor receptor
    Protein Name: Epidermal growth factor receptor
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human EGFR (25-57aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids.
    Isotyp
    IgG
    Top Product
    Discover our top product EGFR Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Lagerung
    4 °C,-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Hao, Yang, Ding, Guo, Zhu, Ji, Zhou, Wu: "Paeoniflorin Potentiates the Inhibitory Effects of Erlotinib in Pancreatic Cancer Cell Lines by Reducing ErbB3 Phosphorylation." in: Scientific reports, Vol. 6, pp. 32809, (2018) (PubMed).

    Shangguan, Jiang, Pan, Xiao, Tan, Tie, Qin, Deng, Chen, Wang: "Glucocorticoid mediates prenatal caffeine exposure-induced endochondral ossification retardation and its molecular mechanism in female fetal rats." in: Cell death & disease, Vol. 8, Issue 10, pp. e3157, (2018) (PubMed).

    Cheng, Li, Liu, Cheng, Ma, Qiu: "YC-1 exerts inhibitory effects on MDA-MB-468 breast cancer cells by targeting EGFR in vitro and in vivo under normoxic condition." in: Chinese journal of cancer, Vol. 31, Issue 5, pp. 248-56, (2013) (PubMed).

    Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

  • Target
    EGFR (Epidermal Growth Factor Receptor (EGFR))
    Andere Bezeichnung
    EGFR (EGFR Produkte)
    Hintergrund
    The epidermal growth factor receptor (EGFR, ErbB-1, HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). EGFR exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). EGFR and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to EGFR overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of EGFR, called EGFRvIII is often observed.

    Synonyms: Epidermal growth factor receptor, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1, EGFR, ERBB, ERBB1, HER1
    Gen-ID
    1956
    UniProt
    P00533
    Pathways
    NF-kappaB Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation, S100 Proteine
Sie sind hier:
Kundenservice