EGFR Antikörper (N-Term)

Produktnummer ABIN5518909

Produktdetails anti-EGFR Antikörper

Target: EGFR (Epidermal Growth Factor Receptor (EGFR))

Bindungsspezifität: AA 25-57, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EGFR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: LEEKKVCQGT SNKLTQLGTF EDHFLSLQRM FNN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Epidermal growth factor receptor(EGFR) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: epidermal growth factor receptor
Protein Name: Epidermal growth factor receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human EGFR (25-57aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-EGFR Antikörper (ABIN5518909)

Hao, Yang, Ding, Guo, Zhu, Ji, Zhou, Wu: "Paeoniflorin Potentiates the Inhibitory Effects of Erlotinib in Pancreatic Cancer Cell Lines by Reducing ErbB3 Phosphorylation." in: Scientific reports, Vol. 6, pp. 32809, (2018) (PubMed).

Shangguan, Jiang, Pan, Xiao, Tan, Tie, Qin, Deng, Chen, Wang: "Glucocorticoid mediates prenatal caffeine exposure-induced endochondral ossification retardation and its molecular mechanism in female fetal rats." in: Cell death & disease, Vol. 8, Issue 10, pp. e3157, (2018) (PubMed).

Cheng, Li, Liu, Cheng, Ma, Qiu: "YC-1 exerts inhibitory effects on MDA-MB-468 breast cancer cells by targeting EGFR in vitro and in vivo under normoxic condition." in: Chinese journal of cancer, Vol. 31, Issue 5, pp. 248-56, (2013) (PubMed).

Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

Details zu EGFR

Target: EGFR (Epidermal Growth Factor Receptor (EGFR))

Andere Bezeichnung: EGFR (EGFR Produkte)

Synonyme: C-erb antikoerper, CG10079 antikoerper, D-EGFR antikoerper, D-Egf antikoerper, DEGFR antikoerper, DER antikoerper, DER flb antikoerper, DER/EGFR antikoerper, DER/faint little ball antikoerper, DER/top antikoerper, DER/torpedo antikoerper, DER1 antikoerper, DEgfr antikoerper, Degfr antikoerper, Der antikoerper, DmHD-33 antikoerper, Dmel\\CG10079 antikoerper, EFG-R antikoerper, EGF-R antikoerper, EGFR antikoerper, EGFr antikoerper, EGfr antikoerper, EK2-6 antikoerper, Egf antikoerper, Egf-r antikoerper, EgfR antikoerper, El antikoerper, Elp antikoerper, Elp-1 antikoerper, Elp-B1 antikoerper, Elp-B1RB1 antikoerper, HD-33 antikoerper, TOP antikoerper, Torpedo/DER antikoerper, Torpedo/Egfr antikoerper, c-erbB antikoerper, d-egf-r antikoerper, dEGFR antikoerper, dEGFR1 antikoerper, dEgfr antikoerper, der antikoerper, egfr antikoerper, flb antikoerper, l(2)05351 antikoerper, l(2)09261 antikoerper, l(2)57DEFa antikoerper, l(2)57EFa antikoerper, l(2)57Ea antikoerper, mor1 antikoerper, top antikoerper, top/DER antikoerper, top/flb antikoerper, torpedo/Egfr antikoerper, torpedo/egfr antikoerper, EGFR12 antikoerper, EGFR15 antikoerper, egfr1 antikoerper, Erbb2 antikoerper, ERBB antikoerper, ERBB1 antikoerper, HER1 antikoerper, PIG61 antikoerper, mENA antikoerper, ErbB-1 antikoerper, Errp antikoerper, 9030024J15Rik antikoerper, AI552599 antikoerper, Erbb antikoerper, Errb1 antikoerper, Wa5 antikoerper, wa-2 antikoerper, wa2 antikoerper, epidermal growth factor receptor antikoerper, Epidermal growth factor receptor antikoerper, epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) antikoerper, EGFR antikoerper, Egfr antikoerper, egfra antikoerper, egfr1 antikoerper, LOC5564544 antikoerper

Hintergrund: The epidermal growth factor receptor (EGFR, ErbB-1, HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). EGFR exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). EGFR and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to EGFR overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of EGFR, called EGFRvIII is often observed.

Synonyms: Epidermal growth factor receptor, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1, EGFR, ERBB, ERBB1, HER1

Gen-ID: 1956

UniProt: P00533

Pathways: NF-kappaB Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Stem Cell Maintenance, Hepatitis C, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation, S100 Proteine