HOXB1 Antikörper (C-Term)
-
- Target Alle HOXB1 Antikörper anzeigen
- HOXB1 (Homeobox B1 (HOXB1))
-
Bindungsspezifität
- AA 176-220, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HOXB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- TARTFDWMKV KRNPPKTAKV SEPGLGSPSG LRTNFTTRQL TELEK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: homeobox B1
Protein Name: Homeobox protein Hox-B1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product HOXB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HOXB1 (Homeobox B1 (HOXB1))
- Andere Bezeichnung
- HOXB1 (HOXB1 Produkte)
- Synonyme
- HCFP3 antikoerper, HOX2 antikoerper, HOX2I antikoerper, Hox-2.9 antikoerper, Z-3 antikoerper, hoxb1 antikoerper, id:ibd3532 antikoerper, Ghox-lab antikoerper, HOXB-1 antikoerper, XHox-b1 antikoerper, hox-2.9 antikoerper, hoxb-1 antikoerper, homeobox B1 antikoerper, homeobox B1a antikoerper, homeo box B1 antikoerper, homeobox protein Hox-B1a antikoerper, homeobox B1 L homeolog antikoerper, HOXB1 antikoerper, Hoxb1 antikoerper, hoxb1a antikoerper, LOC101062167 antikoerper, hoxb1.L antikoerper
- Hintergrund
-
Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Synonyms: Homeobox protein Hox-B1, Homeobox protein Hox-2I, HOXB1, HOX2I - Gen-ID
- 3211
- UniProt
- P14653
-