CDC20 Antikörper
-
- Target Alle CDC20 Antikörper anzeigen
- CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDC20 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Cdc20 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- QTPTKKEHQK AWALNLNGFD VEEAKILRLS GKPQNAPEGY QNRLKVLYSQ KAT
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Cdc20 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cell division cycle 20
Protein Name: Cell division cycle protein 20 homolog - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT).
- Isotyp
- IgG
- Top Product
- Discover our top product CDC20 Primärantikörper
-
-
- Applikationshinweise
- Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))
- Andere Bezeichnung
- CDC20 (CDC20 Produkte)
- Synonyme
- X-FZY antikoerper, ba276h19.3 antikoerper, cdc20a antikoerper, fizzy1 antikoerper, p55cdc antikoerper, CDC20A antikoerper, bA276H19.3 antikoerper, p55CDC antikoerper, 2310042N09Rik antikoerper, C87100 antikoerper, cell division cycle 20 antikoerper, cell division cycle 20 L homeolog antikoerper, cell division cycle 20 homolog (S. cerevisiae) antikoerper, cdc20 antikoerper, CDC20 antikoerper, cdc20.L antikoerper, Cdc20 antikoerper
- Hintergrund
-
The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.
Synonyms: Cell division cycle protein 20 homolog, p55CDC, CDC20 - Gen-ID
- 991
- UniProt
- Q12834
-