Integrin alpha 3a Antikörper (Cytoplasmic Domain, N-Term, Non-phosphorylated)

Produktnummer ABIN5618629

Produktdetails anti-Integrin alpha 3a Antikörper

Target: Integrin alpha 3a

Bindungsspezifität: Cytoplasmic Domain, N-Term, Non-phosphorylated

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3a Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Spezifität: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A

Kreuzreaktivität (Details): Human

Produktmerkmale: Mouse monoclonal Integrin alpha 3A antibody

Immunogen: Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.

Klon: 158A3

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: IHC: 1:100-1:200, WB: 1:100-1:1000

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: Supplied in PBS containing 0.09 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Details zu Integrin alpha 3a

Target: Integrin alpha 3a

Abstract: Integrin alpha 3a Produkte