Integrin alpha 3b Antikörper (Cytoplasmic Domain, N-Term)
Reaktivität: Human
IHC, WB, IHC (fro)
Wirt: Maus
Monoclonal
54B3
unconjugated
-
- Target Alle Integrin alpha 3b Produkte
- Integrin alpha 3b
- Bindungsspezifität
- Cytoplasmic Domain, N-Term
- Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser Integrin alpha 3b Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Spezifität
- Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart
- Kreuzreaktivität (Details)
- Human
- Produktmerkmale
- Mouse monoclonal Integrin alpha 3B antibody
- Immunogen
- Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.
- Klon
- 54B3
- Isotyp
- IgG1
-
-
- Applikationshinweise
- IHC: 1:25-1:200, WB: 1:100-1:1000
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- Supplied in PBS containing 0.09 % sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C
-
- Target
- Integrin alpha 3b
- Abstract
- Integrin alpha 3b Produkte
-
Sie sind hier:
