Annexin VIII Antikörper (AA 20-61)
-
- Target Alle Annexin VIII (ANXA8) Antikörper anzeigen
- Annexin VIII (ANXA8) (Annexin A8 (ANXA8))
-
Bindungsspezifität
- AA 20-61
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin VIII Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ANXA8 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the Annexin VIII antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Annexin VIII (ANXA8) (Annexin A8 (ANXA8))
- Andere Bezeichnung
- Annexin VIII (ANXA8 Produkte)
- Hintergrund
- ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
- UniProt
- P13928
-