ACTN3 Antikörper (AA 574-617)
-
- Target Alle ACTN3 Antikörper anzeigen
- ACTN3 (Actinin, alpha 3 (ACTN3))
-
Bindungsspezifität
- AA 574-617
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ACTN3 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ACTN3 (Actinin, alpha 3 (ACTN3))
- Andere Bezeichnung
- ACTN3 (ACTN3 Produkte)
- Hintergrund
- Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
- UniProt
- Q08043
- Pathways
- Cell-Cell Junction Organization
-