ACTN3 Antikörper (AA 574-617)

Produktnummer ABIN5647038

Produktdetails anti-ACTN3 Antikörper

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Bindungsspezifität: AA 574-617

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Andere Bezeichnung: ACTN3 (ACTN3 Produkte)

Synonyme: CG8953 antikoerper, Dmel\\CG8953 antikoerper, ORF1 antikoerper, acta-3 antikoerper, dabp antikoerper, ACTN2 antikoerper, actn3 antikoerper, actnl antikoerper, zgc:63559 antikoerper, fb95c03 antikoerper, wu:fb95c03 antikoerper, wu:fc11d03 antikoerper, zgc:77243 antikoerper, actinin alpha 3 (gene/pseudogene) antikoerper, actinin alpha 3 antikoerper, alpha actinin 3 antikoerper, actinin alpha 3a antikoerper, actinin alpha 3 (gene/pseudogene) L homeolog antikoerper, alpha-actinin-3 antikoerper, actinin alpha 3b antikoerper, ACTN3 antikoerper, Actn3 antikoerper, actn3a antikoerper, actn3.L antikoerper, actn3 antikoerper, LOC100439754 antikoerper, actn3b antikoerper

Hintergrund: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

UniProt: Q08043

Pathways: Cell-Cell Junction Organization