TUB Antikörper (AA 395-429)

Produktnummer ABIN5647049

Produktdetails anti-TUB Antikörper

Target: TUB (Tubby Homolog (TUB))

Bindungsspezifität: AA 395-429

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 395-429 (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT) from the human protein were used as the immunogen for the Tubby antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Tubby antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Tubby antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu TUB

Target: TUB (Tubby Homolog (TUB))

Andere Bezeichnung: Tubby (TUB Produkte)

Synonyme: rd5 antikoerper, tubby antikoerper, MGC79522 antikoerper, TUB antikoerper, MGC80126 antikoerper, MGC84061 antikoerper, tub antikoerper, tubby bipartite transcription factor antikoerper, tubby bipartite transcription factor S homeolog antikoerper, tub antikoerper, TUB antikoerper, tub.S antikoerper, Tub antikoerper

Hintergrund: Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

UniProt: P50607

Pathways: RTK Signalweg, Sensory Perception of Sound