NFIA Antikörper (AA 180-224)
-
- Target Alle NFIA Antikörper anzeigen
- NFIA (Nuclear Factor I/A (NFIA))
-
Bindungsspezifität
- AA 180-224
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NFIA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product NFIA Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the NFIA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- NFIA (Nuclear Factor I/A (NFIA))
- Andere Bezeichnung
- NFIA (NFIA Produkte)
- Synonyme
- NFIA antikoerper, CTF antikoerper, NF-I/A antikoerper, NF1-A antikoerper, NFI-A antikoerper, NFI-L antikoerper, si:ch211-88d2.2 antikoerper, wu:fq27e07 antikoerper, zgc:158351 antikoerper, CNFI-A antikoerper, cNFI-A3 antikoerper, 1110047K16Rik antikoerper, 9430022M17Rik antikoerper, NF1A antikoerper, nuclear factor I A antikoerper, nuclear factor I/A antikoerper, NFIA antikoerper, nfia antikoerper, Nfia antikoerper
- Hintergrund
- Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
- UniProt
- Q12857
-