PPL Antikörper (AA 1664-1701)
-
- Target Alle PPL Antikörper anzeigen
- PPL (Periplakin (PPL))
-
Bindungsspezifität
- AA 1664-1701
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product PPL Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the Periplakin antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the Periplakin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- PPL (Periplakin (PPL))
- Andere Bezeichnung
- Periplakin (PPL Produkte)
- Hintergrund
- Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.
- UniProt
- O60437
-