RPS6 Antikörper (AA 13-52)

Produktnummer ABIN5647262

Produktdetails anti-RPS6 Antikörper

Target: RPS6 (Ribosomal Protein S6 (RPS6))

Bindungsspezifität: AA 13-52

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 13-52 (QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI) from the human protein were used as the immunogen for the RPS6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the RPS6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the RPS6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu RPS6

Target: RPS6 (Ribosomal Protein S6 (RPS6))

Andere Bezeichnung: RPS6 (RPS6 Produkte)

Synonyme: S6 antikoerper, rps6 antikoerper, rps6a antikoerper, S6R antikoerper, (Rp)S6 antikoerper, CG10944 antikoerper, DS6 antikoerper, Dmel\\CG10944 antikoerper, M(1)7BC antikoerper, M(1)7C antikoerper, RPS6 antikoerper, Rp S6 antikoerper, Rps6 antikoerper, air8 antikoerper, air[8] antikoerper, anon-WO02059370.61 antikoerper, hen antikoerper, l(1)air8 antikoerper, l(1)air[8] antikoerper, l(1)hen antikoerper, pp30 antikoerper, rpS6 antikoerper, wu:fa92e06 antikoerper, wu:fb64g06 antikoerper, zgc:92237 antikoerper, ribosomal protein S6 antikoerper, ribosomal protein S6 S homeolog antikoerper, S6 ribosomal protein antikoerper, Ribosomal protein S6 antikoerper, 30S ribosomal protein S6 antikoerper, 40S ribosomal protein S6 antikoerper, RPS6 antikoerper, rps6.S antikoerper, LOC100135859 antikoerper, Rps6 antikoerper, RpS6 antikoerper, rps6 antikoerper, rps-6 antikoerper, LOC100533219 antikoerper

Hintergrund: Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

UniProt: P62753

Pathways: Carbohydrate Homeostasis, Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly